← New scan

cleansweepchimneyservicesllc.com Backlinks Profile

scan complete · 3ms

Complete backlink analysis for cleansweepchimneyservicesllc.com: Domain Rating, referring domains, and top referrers — all from real Common Crawl data.

20
Domain rating
0–100 authority score
Referring domains
3
unique sites linking to cleansweepchimneyservicesllc.com
Authority rank
#94,813,074
global position in Common Crawl index
Harmonic centrality
10,636,828
raw graph-theoretic score (higher = more central)
PageRank position
#40,953,476
classical PageRank ranking (Google's original signal)
What we measure
Authority signals

Domain Rating computed from the Common Crawl harmonic centrality index — 10B+ links analyzed.

Network breadth

Referring domains = the number of unique websites that link to cleansweepchimneyservicesllc.com, the metric SEOs trust most.

Honest data

We show only what we can measure exactly from the public web graph. No fake "estimated" multipliers.

Top referring domains
Showing 3 of 3 · ranked by authority
Export CSV
// upgrade

Get unlimited backlink checks

Bulk lookups up to 1,000 domains. Full referring domains data. CSV/PDF/API exports. Cancel anytime.

Secure payment via Stripe · Cancel anytime · Compare full plans