cleansweepchimneyservicesllc.com Backlinks Profile
scan complete · 3msComplete backlink analysis for cleansweepchimneyservicesllc.com: Domain Rating, referring domains, and top referrers — all from real Common Crawl data.
Domain rating
0–100 authority score
Referring domains
3
unique sites linking to cleansweepchimneyservicesllc.com
Authority rank
#94,813,074
global position in Common Crawl index
Harmonic centrality
10,636,828
raw graph-theoretic score (higher = more central)
PageRank position
#40,953,476
classical PageRank ranking (Google's original signal)
What we measure
Authority signals
Domain Rating computed from the Common Crawl harmonic centrality index — 10B+ links analyzed.
Network breadth
Referring domains = the number of unique websites that link to cleansweepchimneyservicesllc.com, the metric SEOs trust most.
Honest data
We show only what we can measure exactly from the public web graph. No fake "estimated" multipliers.
Top referring domains
Showing 3 of 3 · ranked by authority
// upgrade
Get unlimited backlink checks
Bulk lookups up to 1,000 domains. Full referring domains data. CSV/PDF/API exports. Cancel anytime.
Starter
$29/mo
Solo SEOs · 100 domains/bulk
Choose Starter →
Best valuePro
$99/mo
Agencies · 1,000 domains/bulk · API
Choose Pro →
Secure payment via Stripe · Cancel anytime · Compare full plans